Lineage for d4l4tc2 (4l4t C:179-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754694Domain d4l4tc2: 4l4t C:179-269 [235263]
    Other proteins in same PDB: d4l4ta1, d4l4ta3, d4l4tb_, d4l4tc1, d4l4tc3, d4l4td2, d4l4tf_, d4l4tg2
    automated match to d1k5na1
    complexed with 6fp

Details for d4l4tc2

PDB Entry: 4l4t (more details), 2 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-6-FP
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4l4tc2:

Sequence, based on SEQRES records: (download)

>d4l4tc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d4l4tc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnralfckahgfyppeiymtwmkngeidygdilpsgdgtyqawasiesnlysc
hvehsgvhmvlqv

SCOPe Domain Coordinates for d4l4tc2:

Click to download the PDB-style file with coordinates for d4l4tc2.
(The format of our PDB-style files is described here.)

Timeline for d4l4tc2: