Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries) |
Domain d4l45a_: 4l45 A: [235261] automated match to d1o6la_ complexed with 5fi |
PDB Entry: 4l45 (more details), 2.9 Å
SCOPe Domain Sequences for d4l45a_:
Sequence, based on SEQRES records: (download)
>d4l45a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgpekirpecfellrvlgkggygkvfqvrkvtgantgkifamkvlkkamivrnakdtaht kaernileevkhpfivdliyafqtggklylileylsggelfmqleregifmedtacfyla eismalghlhqkgiiyrdlkpenimlnhqghvkltdfglckesihdgtvthtfcgtieym apeilmrsghnravdwwslgalmydmltgappftgenrkktidkilkcklnlppyltqea rdllkkllkrnaasrlgagpgdagevqahpffrhinweellarkveppfkpllqseedvs qfdskftrqtpvdspddstlsesanqvflgfeyvaps
>d4l45a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgpekirpecfellrvlgkggygkvfqvrkvtgantgkifamkvlkkamivrnakdtaht kaernileevkhpfivdliyafqtggklylileylsggelfmqleregifmedtacfyla eismalghlhqkgiiyrdlkpenimlnhqghvkltdfglckesgtieymapeilmrsghn ravdwwslgalmydmltgappftgenrkktidkilkcklnlppyltqeardllkkllkrn aasrlgagpgdagevqahpffrhinweellarkveppfkpllqseedvsqfdskftrqtp vesanqvflgfeyvaps
Timeline for d4l45a_: