Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.21: Plus3-like [159042] (1 family) automatically mapped to Pfam PF03126 |
Family b.34.21.1: Plus3 [159043] (2 proteins) Pfam PF03126 |
Protein automated matches [228071] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [228072] (1 PDB entry) |
Domain d4l1pb1: 4l1p B:353-482 [235259] Other proteins in same PDB: d4l1pa2, d4l1pb2 automated match to d4l1pa_ complexed with gol |
PDB Entry: 4l1p (more details), 2.12 Å
SCOPe Domain Sequences for d4l1pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l1pb1 b.34.21.1 (B:353-482) automated matches {Human (Homo sapiens) [TaxId: 9606]} vslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvveta kvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldei nkkelsikea
Timeline for d4l1pb1: