SCOPe 2.07: Domain d4l1pb1: 4l1p B:353-482

Lineage for d4l1pb1 (4l1p B:353-482)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.21: Plus3-like [159042] (1 family)
   automatically mapped to Pfam PF03126

5. Family b.34.21.1: Plus3 [159043] (2 proteins)
   Pfam PF03126

6. Protein automated matches [228071] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [228072] (1 PDB entry)

8. Domain d4l1pb1: 4l1p B:353-482 [235259]
   Other proteins in same PDB: d4l1pa2, d4l1pb2
   automated match to d4l1pa_
   complexed with gol

Details for d4l1pb1

PDB Entry: 4l1p, 2.12 Å

PDB Description: crystal structure of human rtf1 plus3 domain

PDB Compounds: (B:) RNA polymerase-associated protein RTF1 homolog

SCOPe Domain Sequences for d4l1pb1:

Sequence; same for both SEQRES and ATOM records:

>d4l1pb1 b.34.21.1 (B:353-482) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvveta
kvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldei
nkkelsikea

Timeline for d4l1pb1:

• d4l1pb1 first appeared in SCOPe 2.03, called d4l1pb_
  
• d4l1pb1 appears in SCOPe 2.06
  
• d4l1pb1 appears in the current release, SCOPe 2.08