Lineage for d4l1pb1 (4l1p B:353-482)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785340Superfamily b.34.21: Plus3-like [159042] (1 family) (S)
    automatically mapped to Pfam PF03126
  5. 2785341Family b.34.21.1: Plus3 [159043] (2 proteins)
    Pfam PF03126
  6. 2785348Protein automated matches [228071] (1 species)
    not a true protein
  7. 2785349Species Human (Homo sapiens) [TaxId:9606] [228072] (1 PDB entry)
  8. 2785351Domain d4l1pb1: 4l1p B:353-482 [235259]
    Other proteins in same PDB: d4l1pa2, d4l1pb2
    automated match to d4l1pa_
    complexed with gol

Details for d4l1pb1

PDB Entry: 4l1p (more details), 2.12 Å

PDB Description: crystal structure of human rtf1 plus3 domain
PDB Compounds: (B:) RNA polymerase-associated protein RTF1 homolog

SCOPe Domain Sequences for d4l1pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1pb1 b.34.21.1 (B:353-482) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvveta
kvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldei
nkkelsikea

SCOPe Domain Coordinates for d4l1pb1:

Click to download the PDB-style file with coordinates for d4l1pb1.
(The format of our PDB-style files is described here.)

Timeline for d4l1pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l1pb2