![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (98 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [188666] (2 PDB entries) |
![]() | Domain d4l0om_: 4l0o M: [235258] automated match to d4l0oa_ complexed with plp, po4 |
PDB Entry: 4l0o (more details), 2.76 Å
SCOPe Domain Sequences for d4l0om_:
Sequence, based on SEQRES records: (download)
>d4l0om_ c.67.1.0 (M:) automated matches {Helicobacter pylori [TaxId: 85962]} mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv gieheqdlledleqafakig
>d4l0om_ c.67.1.0 (M:) automated matches {Helicobacter pylori [TaxId: 85962]} mrmqtklihggisedattgavsvpiyqtstyrqdaiggyeysrsgnptrfaleeliadle ggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiidtsd isqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqnpll lgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqrgik tlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsftlkn dseavafveslklfilgeslggveslvgipafmagirdglvrlsvgieheqdlledleqa fakig
Timeline for d4l0om_: