Lineage for d4l0oo_ (4l0o O:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132544Species Helicobacter pylori [TaxId:85962] [188666] (2 PDB entries)
  8. 2132554Domain d4l0oo_: 4l0o O: [235257]
    automated match to d4l0oa_
    complexed with plp, po4

Details for d4l0oo_

PDB Entry: 4l0o (more details), 2.76 Å

PDB Description: Structure determination of cystathionine gamma-synthase from Helicobacter pylori
PDB Compounds: (O:) cystathionine gamma-synthase

SCOPe Domain Sequences for d4l0oo_:

Sequence, based on SEQRES records: (download)

>d4l0oo_ c.67.1.0 (O:) automated matches {Helicobacter pylori [TaxId: 85962]}
mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
gieheqdlledleqafaki

Sequence, based on observed residues (ATOM records): (download)

>d4l0oo_ c.67.1.0 (O:) automated matches {Helicobacter pylori [TaxId: 85962]}
mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
lkndseavafveslklfilgeslggveslvgipafmagirdglvrlsvgieheqdlledl
eqafaki

SCOPe Domain Coordinates for d4l0oo_:

Click to download the PDB-style file with coordinates for d4l0oo_.
(The format of our PDB-style files is described here.)

Timeline for d4l0oo_: