Lineage for d1qjy1_ (1qjy 1:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11706Protein Rhinovirus coat protein [49670] (5 species)
  7. 11789Species Human rhinovirus 16 [TaxId:31708] [49672] (6 PDB entries)
  8. 11796Domain d1qjy1_: 1qjy 1: [23525]

Details for d1qjy1_

PDB Entry: 1qjy (more details), 2.8 Å

PDB Description: human rhinovirus 16 coat protein in complex with antiviral compound vp65099

SCOP Domain Sequences for d1qjy1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjy1_ b.10.1.4 (1:) Rhinovirus coat protein {Human rhinovirus 16}
npveryvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq
tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds
eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs
lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka
khtkawcprppravqyshthttnyklssevhndvairprtnlttv

SCOP Domain Coordinates for d1qjy1_:

Click to download the PDB-style file with coordinates for d1qjy1_.
(The format of our PDB-style files is described here.)

Timeline for d1qjy1_: