Lineage for d1qjy1_ (1qjy 1:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) 
Protein Rhinovirus coat protein [49670] (5 species) Species Human rhinovirus 16 [TaxId:31708] [49672] (6 PDB entries) 
Domain d1qjy1_: 1qjy 1: [23525]
Details for d1qjy1_
PDB Entry: 1qjy (more details), 2.8 Å
PDB Description: human rhinovirus 16 coat protein in complex with antiviral compound vp65099
SCOP Domain Sequences for d1qjy1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qjy1_ b.10.1.4 (1:) Rhinovirus coat protein {Human rhinovirus 16}
npveryvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq
tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds
eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs
lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka
khtkawcprppravqyshthttnyklssevhndvairprtnlttv
SCOP Domain Coordinates for d1qjy1_:
Click to download the PDB-style file with coordinates for d1qjy1_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qjy1_:
- d1qjy1_ appears in SCOP 1.57
- d1qjy1_ appears in the current release, SCOPe 2.08
View in 3D
