Lineage for d4kzgf1 (4kzg F:12-334)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006773Family a.118.1.15: Mo25 protein [101407] (2 protein domains)
    automatically mapped to Pfam PF08569
  6. 2006779Protein automated matches [191051] (2 species)
    not a true protein
  7. 2006787Species Zebrafish (Danio rerio) [TaxId:7955] [227884] (1 PDB entry)
  8. 2006793Domain d4kzgf1: 4kzg F:12-334 [235247]
    Other proteins in same PDB: d4kzga2, d4kzgb2, d4kzgc2, d4kzgd2, d4kzge2, d4kzgf2, d4kzgg2, d4kzgh2
    automated match to d4kzgd_

Details for d4kzgf1

PDB Entry: 4kzg (more details), 2.9 Å

PDB Description: Crystal structure of zebrafish MO25
PDB Compounds: (F:) Zgc:86716

SCOPe Domain Sequences for d4kzgf1:

Sequence, based on SEQRES records: (download)

>d4kzgf1 a.118.1.15 (F:12-334) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
padivknlkdnmtilekqdisdkkaekaseevsksllsmkeilygtnekepqteavaqla
qelynsgllstlvadlqlidfegkkdvaqifndilrrqigtrtptveylctqqnilfmll
kgyespdialncgimlrecirheplakitlcseqfydffryvemstfdiasdafatfkdl
ltrhkvlsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyis
kpenlklmmnllrdksrniqfeafhvfkvfvanpnktppildillknqtklieflskfqn
draedeqfsdektylikqirdlk

Sequence, based on observed residues (ATOM records): (download)

>d4kzgf1 a.118.1.15 (F:12-334) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
padivknlkdnmtileksdkkaekaseevsksllsmkeilygtnpqteavaqlaqelyns
gllstlvadlqlidfegkkdvaqifndilrrqigtrtptveylctqqnilfmllkgyesp
dialncgimlrecirheplakitlcseqfydffryvemstfdiasdafatfkdlltrhkv
lsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyiskpenlk
lmmnllrdksrniqfeafhvfkvfvanpnktppildillknqtklieflskfqndrdeqf
sdektylikqirdlk

SCOPe Domain Coordinates for d4kzgf1:

Click to download the PDB-style file with coordinates for d4kzgf1.
(The format of our PDB-style files is described here.)

Timeline for d4kzgf1: