SCOPe 2.06: Domain d4kxhb_: 4kxh B:

Lineage for d4kxhb_ (4kxh B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries)

8. Domain d4kxhb_: 4kxh B: [235240]
   automated match to d4kxha_
   complexed with cl, na, so4

Details for d4kxhb_

PDB Entry: 4kxh, 2.7 Å

PDB Description: the x-ray crystal structure of a dimeric variant of human pancreatic ribonuclease

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d4kxhb_:

Sequence; same for both SEQRES and ATOM records:

>d4kxhb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
kesrakkfqrqhmdsssstycnqmmrrrnmtqgrckpvntfvheplvdvqnvcfqekvtc
kngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasve

Timeline for d4kxhb_:

• d4kxhb_ first appeared in SCOPe 2.03
  
• d4kxhb_ appears in SCOPe 2.05
  
• d4kxhb_ appears in SCOPe 2.07
  
• d4kxhb_ appears in the current release, SCOPe 2.08