Lineage for d4kxhb_ (4kxh B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890160Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 1890392Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries)
  8. 1890403Domain d4kxhb_: 4kxh B: [235240]
    automated match to d4kxha_
    complexed with cl, na, so4

Details for d4kxhb_

PDB Entry: 4kxh (more details), 2.7 Å

PDB Description: the x-ray crystal structure of a dimeric variant of human pancreatic ribonuclease
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d4kxhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxhb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
kesrakkfqrqhmdsssstycnqmmrrrnmtqgrckpvntfvheplvdvqnvcfqekvtc
kngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasve

SCOPe Domain Coordinates for d4kxhb_:

Click to download the PDB-style file with coordinates for d4kxhb_.
(The format of our PDB-style files is described here.)

Timeline for d4kxhb_: