Lineage for d4kwib1 (4kwi B:2-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848683Species Streptomyces cyanogenus [TaxId:80860] [235237] (3 PDB entries)
  8. 2848687Domain d4kwib1: 4kwi B:2-253 [235239]
    Other proteins in same PDB: d4kwib2
    automated match to d1hxha_
    complexed with 1tj, nap, peg

Details for d4kwib1

PDB Entry: 4kwi (more details), 2 Å

PDB Description: the crystal structure of angucycline c-6 ketoreductase lanv with bound nadp and 11-deoxy-6-oxylandomycinone
PDB Compounds: (B:) Reductase homolog

SCOPe Domain Sequences for d4kwib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kwib1 c.2.1.0 (B:2-253) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
gnltgktalvtgasrgigraiaeklgyagalvavhyatgadaaaevaesiekdggraftv
kaelgvpgdvdvlfeglerglkertgatdldilvnnagvmamgapeevtpemfdrmmavn
akapffivqralsvmpdggriinvssgltrvaspdqvtygmskgaleqialhfsrhlgsr
ritvnsvapgstdngsalfqipevretlsqlstfgevaepaaiadvvaflasedarwitg
afidasggtllg

SCOPe Domain Coordinates for d4kwib1:

Click to download the PDB-style file with coordinates for d4kwib1.
(The format of our PDB-style files is described here.)

Timeline for d4kwib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kwib2
View in 3D
Domains from other chains:
(mouse over for more information)
d4kwia_