Lineage for d4kuce_ (4kuc E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1521000Domain d4kuce_: 4kuc E: [235236]
    Other proteins in same PDB: d4kuca_, d4kuci_
    automated match to d4kucd1
    protein/RNA complex

Details for d4kuce_

PDB Entry: 4kuc (more details), 2.79 Å

PDB Description: Crystal structure of ricin-A chain in complex with the antibody 6C2
PDB Compounds: (E:) mAb6c2 fab-Heavy chain

SCOPe Domain Sequences for d4kuce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kuce_ b.1.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratisyrasksvsymhwnqqkpgqpprlliylgsnlesgvgar
fsgsgsgtdftlnihpveeedaatyycqhkreypptfgqgtkveikrtv

SCOPe Domain Coordinates for d4kuce_:

Click to download the PDB-style file with coordinates for d4kuce_.
(The format of our PDB-style files is described here.)

Timeline for d4kuce_: