![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.12: BAH domain [82061] (2 families) ![]() |
![]() | Family b.34.12.0: automated matches [191438] (1 protein) not a true family |
![]() | Protein automated matches [190644] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [235233] (3 PDB entries) |
![]() | Domain d4kula_: 4kul A: [235234] automated match to d1m4za_ mutant |
PDB Entry: 4kul (more details), 2.62 Å
SCOPe Domain Sequences for d4kula_:
Sequence, based on SEQRES records: (download)
>d4kula_ b.34.12.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ldgwqviitddqgrviddnnrrrsrkrggenvflkrisdglsfgkgesvifndnvtetys vyliheirlntlnnvpeiwvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnev nkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryaceptaekfvpi difqiirrvkemepkqsdeylkrvsvp
>d4kula_ b.34.12.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ldgwqviitddqgrvidgenvflkrisdglsfgkgesvifndnvtetysvyliheirlnn vpeiwvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnevnkselyltaelsei wlkdfiavgqilpesqwndssidkiedrdflvryaceptaekfvpidifqiirrvkemep kqsdeylkrvsvp
Timeline for d4kula_: