Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
Domain d4ktha1: 4kth A:1-321 [235229] Other proteins in same PDB: d4ktha2, d4kthb_, d4kthc2, d4kthd1, d4kthd2, d4kthe2, d4kthf_ automated match to d4kthe_ complexed with nag |
PDB Entry: 4kth (more details), 2.6 Å
SCOPe Domain Sequences for d4ktha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ktha1 b.19.1.2 (A:1-321) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvagw llgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipkn swsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlwgihh pndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpndaih fesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihpltig ecpkyvksnklvlatglrnsp
Timeline for d4ktha1: