Lineage for d4ks5a_ (4ks5 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2075178Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2075179Protein automated matches [190692] (15 species)
    not a true protein
  7. 2075301Species Influenza a virus [TaxId:385580] [228660] (8 PDB entries)
  8. 2075308Domain d4ks5a_: 4ks5 A: [235223]
    automated match to d4ks1a_
    complexed with 1so, ca

Details for d4ks5a_

PDB Entry: 4ks5 (more details), 2.7 Å

PDB Description: Influenza neuraminidase in complex with antiviral compound (3S,4R,5R)-4-(acetylamino)-3-[4-(2-hydroxypropan-2-yl)-1H-1,2,3-triazol-1-yl]-5-(pentan-3-yloxy)cyclohex-1-ene-1-carboxylic acid
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4ks5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ks5a_ b.68.1.0 (A:) automated matches {Influenza a virus [TaxId: 385580]}
tymnnteaicdvkgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvkvgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvinswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqadisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
sdtprgedaqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqvrkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyeiadwswhdgailpfdid

SCOPe Domain Coordinates for d4ks5a_:

Click to download the PDB-style file with coordinates for d4ks5a_.
(The format of our PDB-style files is described here.)

Timeline for d4ks5a_: