SCOPe 2.04: Domain d4krla1: 4krl A:307-480

Lineage for d4krla1 (4krl A:307-480)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.5: L domain [52071] (6 proteins)

6. Protein automated matches [232361] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232384] (3 PDB entries)

8. Domain d4krla1: 4krl A:307-480 [235219]
   Other proteins in same PDB: d4krla2, d4krlb_
   automated match to d3b2ua1
   complexed with iod, mes, nag

Details for d4krla1

PDB Entry: 4krl, 2.85 Å

PDB Description: nanobody/vhh domain 7d12 in complex with domain iii of the extracellular region of egfr, ph 6.0

PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4krla1:

Sequence; same for both SEQRES and ATOM records:

>d4krla1 c.10.2.5 (A:307-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

Timeline for d4krla1:

• d4krla1 first appeared in SCOPe 2.03
  
• d4krla1 appears in SCOPe 2.05
  
• d4krla1 appears in the current release, SCOPe 2.07