Lineage for d4kr5b_ (4kr5 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391676Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1391677Protein automated matches [190039] (57 species)
    not a true protein
  7. 1391827Species Lactococcus lactis [TaxId:272623] [227880] (4 PDB entries)
  8. 1391834Domain d4kr5b_: 4kr5 B: [235218]
    automated match to d4kqpa_
    complexed with cl, mg, p33, p6g, pe4, peg, pg0

Details for d4kr5b_

PDB Entry: 4kr5 (more details), 1.5 Å

PDB Description: Crystal structure of Lactococcus lactis GlnP substrate binding domain 2 (SBD2) in open conformation
PDB Compounds: (B:) Glutamine ABC transporter permease and substrate binding protein protein

SCOPe Domain Sequences for d4kr5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kr5b_ c.94.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 272623]}
gmatpkkdvytiasdnsfapfefqnddkqftgidvdllnaiaknqgfklkwnfigfqaav
dsvqsghadgmmsgmsitdarkqvfdygspyyssnltiatsstddsikswkdlkgktlga
kngtasfdylnahakeygytvktftdattmysslnngsinalmddepvikyaikqgqkfa
tpikpipdgqygfavkkgsnpeliemfnnglanlrangeydkiidkylesda

SCOPe Domain Coordinates for d4kr5b_:

Click to download the PDB-style file with coordinates for d4kr5b_.
(The format of our PDB-style files is described here.)

Timeline for d4kr5b_:

  • d4kr5b_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-12
  • d4kr5b_ appears in SCOPe 2.04
  • d4kr5b_ appears in the current release, SCOPe 2.07, called d4kr5b1