Lineage for d4kr5a1 (4kr5 A:255-481)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523015Species Lactococcus lactis [TaxId:272623] [227880] (6 PDB entries)
  8. 2523021Domain d4kr5a1: 4kr5 A:255-481 [235217]
    Other proteins in same PDB: d4kr5a2, d4kr5b2
    automated match to d4kqpa_
    complexed with cl, mg, p33, p6g, pe4, peg, pg0

Details for d4kr5a1

PDB Entry: 4kr5 (more details), 1.5 Å

PDB Description: Crystal structure of Lactococcus lactis GlnP substrate binding domain 2 (SBD2) in open conformation
PDB Compounds: (A:) Glutamine ABC transporter permease and substrate binding protein protein

SCOPe Domain Sequences for d4kr5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kr5a1 c.94.1.0 (A:255-481) automated matches {Lactococcus lactis [TaxId: 272623]}
atpkkdvytiasdnsfapfefqnddkqftgidvdllnaiaknqgfklkwnfigfqaavds
vqsghadgmmsgmsitdarkqvfdygspyyssnltiatsstddsikswkdlkgktlgakn
gtasfdylnahakeygytvktftdattmysslnngsinalmddepvikyaikqgqkfatp
ikpipdgqygfavkkgsnpeliemfnnglanlrangeydkiidkyle

SCOPe Domain Coordinates for d4kr5a1:

Click to download the PDB-style file with coordinates for d4kr5a1.
(The format of our PDB-style files is described here.)

Timeline for d4kr5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kr5a2