Lineage for d4kqob1 (4kqo B:58-221)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237129Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2237130Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2237166Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 2237167Protein automated matches [226981] (10 species)
    not a true protein
  7. 2237187Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [228776] (15 PDB entries)
  8. 2237204Domain d4kqob1: 4kqo B:58-221 [235207]
    Other proteins in same PDB: d4kqoa2, d4kqob2
    automated match to d4kqoa1
    complexed with cl, gol, imd, jpp

Details for d4kqob1

PDB Entry: 4kqo (more details), 2.31 Å

PDB Description: Crystal structure of penicillin-binding protein 3 from pseudomonas aeruginosa in complex with piperacillin
PDB Compounds: (B:) penicillin-binding protein 3

SCOPe Domain Sequences for d4kqob1:

Sequence, based on SEQRES records: (download)

>d4kqob1 d.175.1.0 (B:58-221) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
ipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadrieqn
aerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddrgreg
ielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Sequence, based on observed residues (ATOM records): (download)

>d4kqob1 d.175.1.0 (B:58-221) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
ipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadrieqn
aerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddrgreg
ielafdewlagvpgkvtknakpgktlal

SCOPe Domain Coordinates for d4kqob1:

Click to download the PDB-style file with coordinates for d4kqob1.
(The format of our PDB-style files is described here.)

Timeline for d4kqob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kqob2