SCOPe 2.05: Domain d4kopb_: 4kop B:

Lineage for d4kopb_ (4kop B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families)

5. Family d.18.1.0: automated matches [191638] (1 protein)
   not a true family

6. Protein automated matches [191174] (3 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [228960] (1 PDB entry)

8. Domain d4kopb_: 4kop B: [235206]
   automated match to d4kopa_
   complexed with mpo

Details for d4kopb_

PDB Entry: 4kop, 1.75 Å

PDB Description: crystal structure of why2 from arabidopsis thaliana

PDB Compounds: (B:) Single-stranded DNA-binding protein WHY2, mitochondrial

SCOPe Domain Sequences for d4kopb_:

Sequence, based on SEQRES records:

>d4kopb_ d.18.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk
falsptevgslismgskdsseffhdpsmkssnagqvrkslsvkphadgsgyfislsvnns
ilktndyfvvpvtkaefavmktafsfalphimgwnrltg

Sequence, based on observed residues (ATOM records):

>d4kopb_ d.18.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk
falsptevgslismgskdsseffhdpqvrkslsvkphadgsgyfislsvnnsilktndyf
vvpvtkaefavmktafsfalphimgwnrltg

Timeline for d4kopb_:

• d4kopb_ first appeared in SCOPe 2.03
  
• d4kopb_ appears in SCOPe 2.04
  
• d4kopb_ appears in SCOPe 2.06
  
• d4kopb_ appears in the current release, SCOPe 2.08