SCOPe 2.03: Domain d4kopc_: 4kop C:

Lineage for d4kopc_ (4kop C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families)

5. Family d.18.1.0: automated matches [191638] (1 protein)
   not a true family

6. Protein automated matches [191174] (2 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [228960] (1 PDB entry)

8. Domain d4kopc_: 4kop C: [235205]
   automated match to d4kopa_
   complexed with mpo

Details for d4kopc_

PDB Entry: 4kop, 1.75 Å

PDB Description: crystal structure of why2 from arabidopsis thaliana

PDB Compounds: (C:) Single-stranded DNA-binding protein WHY2, mitochondrial

SCOPe Domain Sequences for d4kopc_:

Sequence, based on SEQRES records:

>d4kopc_ d.18.1.0 (C:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk
falsptevgslismgskdsseffhdpsmkssnagqvrkslsvkphadgsgyfislsvnns
ilktndyfvvpvtkaefavmktafsfalphimgwnrltg

Sequence, based on observed residues (ATOM records):

>d4kopc_ d.18.1.0 (C:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk
falsptevgslismgskdsseffhdpgqvrkslsvkphadgsgyfislsvnnsilktndy
fvvpvtkaefavmktafsfalphimgwnrltg

Timeline for d4kopc_:

• d4kopc_ is new in SCOPe 2.03-stable
  
• d4kopc_ appears in SCOPe 2.04
  
• d4kopc_ appears in the current release, SCOPe 2.08