Lineage for d4kopc_ (4kop C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2162927Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2162928Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2162986Family d.18.1.0: automated matches [191638] (1 protein)
    not a true family
  6. 2162987Protein automated matches [191174] (3 species)
    not a true protein
  7. 2162999Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [228960] (1 PDB entry)
  8. 2163002Domain d4kopc_: 4kop C: [235205]
    Other proteins in same PDB: d4kopa2
    automated match to d4kopa_
    complexed with mpo

Details for d4kopc_

PDB Entry: 4kop (more details), 1.75 Å

PDB Description: crystal structure of why2 from arabidopsis thaliana
PDB Compounds: (C:) Single-stranded DNA-binding protein WHY2, mitochondrial

SCOPe Domain Sequences for d4kopc_:

Sequence, based on SEQRES records: (download)

>d4kopc_ d.18.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk
falsptevgslismgskdsseffhdpsmkssnagqvrkslsvkphadgsgyfislsvnns
ilktndyfvvpvtkaefavmktafsfalphimgwnrltg

Sequence, based on observed residues (ATOM records): (download)

>d4kopc_ d.18.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk
falsptevgslismgskdsseffhdpgqvrkslsvkphadgsgyfislsvnnsilktndy
fvvpvtkaefavmktafsfalphimgwnrltg

SCOPe Domain Coordinates for d4kopc_:

Click to download the PDB-style file with coordinates for d4kopc_.
(The format of our PDB-style files is described here.)

Timeline for d4kopc_: