Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily) helix-swapped dimer of beta(4)-alpha motifs |
Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) |
Family d.18.1.2: Plant transcriptional regulator PBF-2 [75375] (2 proteins) single-chain domain formed by a tandem repeat of two motifs |
Protein automated matches [228955] (1 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [228956] (2 PDB entries) |
Domain d4koob_: 4koo B: [235203] Other proteins in same PDB: d4kooa2, d4kooc2, d4kood2 automated match to d4kood_ complexed with mes, ni, po4 |
PDB Entry: 4koo (more details), 1.88 Å
SCOPe Domain Sequences for d4koob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4koob_ d.18.1.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} parfyvghsiykgkaaltvdprapefvaldsgafklskdgflllqfapsagvrqydwskk qvfslsvteigtlvslgpresceffhdpfkgksdegkvrkvlkveplpdgsghffnlsvq nklvnvdesiyipitraefavlisafnfvlpyligwhafans
Timeline for d4koob_: