SCOPe 2.03: Domain d4knsf1: 4kns F:25-153

Lineage for d4knsf1 (4kns F:25-153)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (8 species)
   not a true protein

7. Species Nitrosomonas europaea [TaxId:228410] [235189] (2 PDB entries)

8. Domain d4knsf1: 4kns F:25-153 [235192]
   automated match to d1kbva1
   complexed with cl, cu, gol

Details for d4knsf1

PDB Entry: 4kns, 2.2 Å

PDB Description: Reduced crystal structure of the Nitrosomonas europaea copper nitrite reductase at pH 6.5

PDB Compounds: (F:) Multicopper oxidase type 1

SCOPe Domain Sequences for d4knsf1:

Sequence; same for both SEQRES and ATOM records:

>d4knsf1 b.6.1.0 (F:25-153) automated matches {Nitrosomonas europaea [TaxId: 228410]}
ktvqvtlhavetdvaydnkgstyrawtfdgkvpgpvvrvtegdtveftlindknsknshs
mdfhaarldvvedfesikpgetkkytftadnpgvffyhcgsdpmiqhiargmygviivdp
kdanalpka

Timeline for d4knsf1:

• d4knsf1 is new in SCOPe 2.03-stable
  
• d4knsf1 appears in SCOPe 2.04
  
• d4knsf1 appears in the current release, SCOPe 2.08