Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
Protein Rhinovirus coat protein [49670] (5 species) |
Species Human rhinovirus 16 [TaxId:31708] [49672] (6 PDB entries) |
Domain d1aym1_: 1aym 1: [23519] |
PDB Entry: 1aym (more details), 2.15 Å
SCOP Domain Sequences for d1aym1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aym1_ b.10.1.4 (1:) Rhinovirus coat protein {Human rhinovirus 16} npveryvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka khtkawcprppravqyshthttnyklssevhndvairprtnlttv
Timeline for d1aym1_: