Lineage for d4kneb_ (4kne B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511708Species Mycobacterium tuberculosis [TaxId:1773] [230073] (6 PDB entries)
  8. 2511717Domain d4kneb_: 4kne B: [235188]
    automated match to d4klxb_
    complexed with 1cy, atr

Details for d4kneb_

PDB Entry: 4kne (more details), 2 Å

PDB Description: crystal structure of dihydrofolate reductase from mycobacterium tuberculosis in complex with cycloguanil
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4kneb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kneb_ c.71.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

SCOPe Domain Coordinates for d4kneb_:

Click to download the PDB-style file with coordinates for d4kneb_.
(The format of our PDB-style files is described here.)

Timeline for d4kneb_: