Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (21 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [230073] (6 PDB entries) |
Domain d4knea_: 4kne A: [235187] automated match to d4klxb_ complexed with 1cy, atr |
PDB Entry: 4kne (more details), 2 Å
SCOPe Domain Sequences for d4knea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4knea_ c.71.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp reagdalapvldetwrgetgewrfsrsglryrlysyhrs
Timeline for d4knea_: