SCOPe 2.05: Domain d4km2a_: 4km2 A:

Lineage for d4km2a_ (4km2 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [230073] (6 PDB entries)

8. Domain d4km2a_: 4km2 A: [235186]
   automated match to d4klxb_
   complexed with atr, top

Details for d4km2a_

PDB Entry: 4km2, 1.4 Å

PDB Description: crystal structure of dihydrofolate reductase from mycobacterium tuberculosis in an open conformation in complex with trimethoprim

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4km2a_:

Sequence; same for both SEQRES and ATOM records:

>d4km2a_ c.71.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d4km2a_:

• d4km2a_ first appeared in SCOPe 2.03
  
• d4km2a_ appears in SCOPe 2.04
  
• d4km2a_ appears in SCOPe 2.06
  
• d4km2a_ appears in the current release, SCOPe 2.08