Lineage for d4km2b_ (4km2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904254Species Mycobacterium tuberculosis [TaxId:1773] [230073] (6 PDB entries)
  8. 2904261Domain d4km2b_: 4km2 B: [235185]
    automated match to d4klxb_
    complexed with atr, top

Details for d4km2b_

PDB Entry: 4km2 (more details), 1.4 Å

PDB Description: crystal structure of dihydrofolate reductase from mycobacterium tuberculosis in an open conformation in complex with trimethoprim
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4km2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4km2b_ c.71.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

SCOPe Domain Coordinates for d4km2b_:

Click to download the PDB-style file with coordinates for d4km2b_.
(The format of our PDB-style files is described here.)

Timeline for d4km2b_: