Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily) core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest |
Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) |
Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins) common fold is decorated with several large insertions automatically mapped to Pfam PF00245 |
Protein automated matches [190176] (2 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [228351] (2 PDB entries) |
Domain d4kjgb_: 4kjg B: [235181] automated match to d4kjga_ complexed with 4np, mg, nag, zn |
PDB Entry: 4kjg (more details), 2.38 Å
SCOPe Domain Sequences for d4kjgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kjgb_ c.76.1.1 (B:) automated matches {Rattus norvegicus [TaxId: 10116]} vipveeenpvfwnqkakealdvakklqpiqtsaknlilflgdgmgvptvtatrilkgqlg ghlgpetplamdhfpftalsktynvdrqvpdsagtataylcgvkanyktigvsaaarfnq cnstfgnevfsvmhrakkagksvgvvtttrvqhaspagtyahtvnrdwysdadmpssalq egckdiatqlisnmdidvilgggrkfmfpkgtpdpeypgdsdqsgvrldsrnlveewlak yqgtryvwnreqlmqasqdpavtrlmglfeptemkydvnrnasadpslaemtevavrlls rnpqgfylfveggridqghhagtaylalteavmfdsaiekasqltnekdtltlitadhsh vfafggytlrgtsifglaplnaqdgksytsilygngpgyvlnsgnrpnvtdaesgdvnyk qqaavplssethggedvaifargpqahlvhgvqeqnyiahvmafagclepytdcglappa dehh
Timeline for d4kjgb_: