Lineage for d4kjda_ (4kjd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138455Family c.76.1.1: Alkaline phosphatase [53650] (2 protein domains)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2138558Protein automated matches [190176] (2 species)
    not a true protein
  7. 2138567Species Norway rat (Rattus norvegicus) [TaxId:10116] [228351] (2 PDB entries)
  8. 2138568Domain d4kjda_: 4kjd A: [235179]
    automated match to d4kjga_
    complexed with gol, mg

Details for d4kjda_

PDB Entry: 4kjd (more details), 2.21 Å

PDB Description: RatIntestinal AP expressed in E. coli
PDB Compounds: (A:) Intestinal-type alkaline phosphatase 1

SCOPe Domain Sequences for d4kjda_:

Sequence, based on SEQRES records: (download)

>d4kjda_ c.76.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
veeenpvfwnqkakealdvakklqpiqtsaknlilflgdgmgvptvtatrilkgqlgghl
gpetplamdhfpftalsktynvdrqvpdsagtataylcgvkanyktigvsaaarfnqcns
tfgnevfsvmhrakkagksvgvvtttrvqhaspagtyahtvnrdwysdadmpssalqegc
kdiatqlisnmdidvilgggrkfmfpkgtpdpeypgdsdqsgvrldsrnlveewlakyqg
tryvwnreqlmqasqdpavtrlmglfeptemkydvnrnasadpslaemtevavrllsrnp
qgfylfveggridqghhagtaylalteavmfdsaiekasqltnekdtltlitadhshvfa
fggytlrgtsifglaplnaqdgksytsilygngpgyvlnsgnrpnvtdaesgdvnykqqa
avplssethggedvaifargpqahlvhgvqeqnyiahvmafagclepytdcglappad

Sequence, based on observed residues (ATOM records): (download)

>d4kjda_ c.76.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
veeenpvfwnqkakealdvakklqpiqtsaknlilflgdgmgvptvtatrilkgqlgghl
gpetplamdhfpftalsktynvdrqvpdsagtataylcgvkanyktigvsaaarfnqcns
tfgnevfsvmhrakkagksvgvvtttrvqhaspagtyahtvnrdwysdadmpssalqegc
kdiatqlisnmdidvilgggrkfmfpkgtpdpeypgdsdqsgvrldsrnlveewlakyqg
tryvwnreqlmqasqdpavtrlmglfeptemkydvnrnasadpslaemtevavrllsrnp
qgfylfveggridqghtaylalteavmfdsaiekasqltnekdtltlitadhshvtlrhg
gedvaifargpqahlvhgvqeqnyiahvmafagclepytdcglappad

SCOPe Domain Coordinates for d4kjda_:

Click to download the PDB-style file with coordinates for d4kjda_.
(The format of our PDB-style files is described here.)

Timeline for d4kjda_: