Lineage for d4ki4a2 (4ki4 A:376-901)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622071Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2622168Protein Family B DNA polymerase [56680] (7 species)
  7. 2622169Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)
  8. 2622238Domain d4ki4a2: 4ki4 A:376-901 [235176]
    Other proteins in same PDB: d4ki4a1
    automated match to d4khqa2
    protein/DNA complex; complexed with ca, gol, na, ttp; mutant

Details for d4ki4a2

PDB Entry: 4ki4 (more details), 2.45 Å

PDB Description: Ternary complex of rb69 mutant L415F with ribonucleotides at 0 and -1 position
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4ki4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ki4a2 e.8.1.1 (A:376-901) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltsfypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmf

SCOPe Domain Coordinates for d4ki4a2:

Click to download the PDB-style file with coordinates for d4ki4a2.
(The format of our PDB-style files is described here.)

Timeline for d4ki4a2: