Lineage for d4khna1 (4khn A:1-375)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374321Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1374322Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 1374323Species Bacteriophage RB69 [TaxId:12353] [53127] (49 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 1374362Domain d4khna1: 4khn A:1-375 [235165]
    Other proteins in same PDB: d4khna2, d4khnb2
    automated match to d4khnb1
    protein/DNA complex; complexed with ca, gol, na, so4, xg4; mutant

Details for d4khna1

PDB Entry: 4khn (more details), 2.55 Å

PDB Description: Crystal structure of the ternary complex of the D714A mutant of RB69 DNA polymerase
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4khna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4khna1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOPe Domain Coordinates for d4khna1:

Click to download the PDB-style file with coordinates for d4khna1.
(The format of our PDB-style files is described here.)

Timeline for d4khna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4khna2