Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (6 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (8 PDB entries) |
Domain d4khab1: 4kha B:14-102 [235164] Other proteins in same PDB: d4khab2 automated match to d1hioa_ complexed with cl, trs |
PDB Entry: 4kha (more details), 2.35 Å
SCOPe Domain Sequences for d4khab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4khab1 a.22.1.1 (B:14-102) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn kktriiprhlqlavrndeelnkllgrvti
Timeline for d4khab1: