SCOPe 2.06: Domain d4khab1: 4kha B:14-102

Lineage for d4khab1 (4kha B:14-102)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (8 PDB entries)

8. Domain d4khab1: 4kha B:14-102 [235164]
   Other proteins in same PDB: d4khab2
   automated match to d1hioa_
   complexed with cl, trs

Details for d4khab1

PDB Entry: 4kha, 2.35 Å

PDB Description: structural basis of histone h2a-h2b recognition by the essential chaperone fact

PDB Compounds: (B:) histone h2a

SCOPe Domain Sequences for d4khab1:

Sequence; same for both SEQRES and ATOM records:

>d4khab1 a.22.1.1 (B:14-102) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvti

Timeline for d4khab1:

• d4khab1 first appeared in SCOPe 2.03, called d4khab_
  
• d4khab1 was called d4khab_ in SCOPe 2.05
  
• d4khab1 appears in SCOPe 2.07
  
• d4khab1 appears in the current release, SCOPe 2.08