Lineage for d4kbac_ (4kba C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542771Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2542777Species Human (Homo sapiens) [TaxId:9606] [224941] (20 PDB entries)
  8. 2542788Domain d4kbac_: 4kba C: [235130]
    automated match to d4kbad_
    complexed with 1qm, so4

Details for d4kbac_

PDB Entry: 4kba (more details), 1.98 Å

PDB Description: CK1d in complex with 9-[3-(4-fluorophenyl)-1-methyl-1H-pyrazol-4-yl]-2,3,4,5-tetrahydropyrido[2,3-f][1,4]oxazepine inhibitor
PDB Compounds: (C:) Casein kinase I isoform delta

SCOPe Domain Sequences for d4kbac_:

Sequence, based on SEQRES records: (download)

>d4kbac_ d.144.1.7 (C:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
nryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgip
tirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfih
rdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthl
gieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgyps
efatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

Sequence, based on observed residues (ATOM records): (download)

>d4kbac_ d.144.1.7 (C:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
nryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgip
tirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfih
rdvkpdnflmglgkkgnlvyiidfglakkyyrenknltgtaryasinthlgieqsrrddl
eslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatylnfcr
slrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

SCOPe Domain Coordinates for d4kbac_:

Click to download the PDB-style file with coordinates for d4kbac_.
(The format of our PDB-style files is described here.)

Timeline for d4kbac_: