Lineage for d4kbba2 (4kbb A:1080-1291)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053907Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 protein domains)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2053908Protein Botulinum neurotoxin [50402] (2 species)
  7. 2053909Species Clostridium botulinum, serotype A [TaxId:1491] [50403] (6 PDB entries)
  8. 2053911Domain d4kbba2: 4kbb A:1080-1291 [235127]
    Other proteins in same PDB: d4kbba1, d4kbbb1
    automated match to d3btaa2
    complexed with cl, mg

Details for d4kbba2

PDB Entry: 4kbb (more details), 2.3 Å

PDB Description: Structure of Botulinum neurotoxin B binding domain in complex with both synaptotagmin II and GD1a
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d4kbba2:

Sequence, based on SEQRES records: (download)

>d4kbba2 b.42.4.2 (A:1080-1291) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
yseylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdl
yigekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapis
dsdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfci
skwylkevkrkpynlklgcnwqfipkdegwte

Sequence, based on observed residues (ATOM records): (download)

>d4kbba2 b.42.4.2 (A:1080-1291) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
yseylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdl
yigekfiirrksdivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdefyn
tiqikeydeqptyscqllfkkdeestdeigligihrfyeeykdyfciskwylkevkrkpy
nlklgcnwqfipkdegwte

SCOPe Domain Coordinates for d4kbba2:

Click to download the PDB-style file with coordinates for d4kbba2.
(The format of our PDB-style files is described here.)

Timeline for d4kbba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kbba1