Lineage for d4kbba1 (4kbb A:862-1079)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779820Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2779821Protein Botulinum neurotoxin [49959] (2 species)
  7. 2779822Species Clostridium botulinum, serotype A [TaxId:1491] [49960] (10 PDB entries)
  8. 2779826Domain d4kbba1: 4kbb A:862-1079 [235125]
    Other proteins in same PDB: d4kbba2, d4kbbb2
    automated match to d3btaa1
    complexed with cl, mg

Details for d4kbba1

PDB Entry: 4kbb (more details), 2.3 Å

PDB Description: structure of botulinum neurotoxin b binding domain in complex with both synaptotagmin ii and gd1a
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d4kbba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kbba1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
nniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifns
vfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingk
tksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeii
fkldgdidrtqfiwmkyfsifntelsqsnieerykiqs

SCOPe Domain Coordinates for d4kbba1:

Click to download the PDB-style file with coordinates for d4kbba1.
(The format of our PDB-style files is described here.)

Timeline for d4kbba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kbba2