SCOPe 2.06: Domain d4kbbb1: 4kbb B:862-1079

Lineage for d4kbbb1 (4kbb B:862-1079)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein Botulinum neurotoxin [49959] (2 species)

7. Species Clostridium botulinum, serotype A [TaxId:1491] [49960] (6 PDB entries)

8. Domain d4kbbb1: 4kbb B:862-1079 [235124]
   Other proteins in same PDB: d4kbba2, d4kbbb2
   automated match to d3btaa1
   complexed with cl, mg

Details for d4kbbb1

PDB Entry: 4kbb, 2.3 Å

PDB Description: structure of botulinum neurotoxin b binding domain in complex with both synaptotagmin ii and gd1a

PDB Compounds: (B:) botulinum neurotoxin type b

SCOPe Domain Sequences for d4kbbb1:

Sequence; same for both SEQRES and ATOM records:

>d4kbbb1 b.29.1.6 (B:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
nniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifns
vfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingk
tksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeii
fkldgdidrtqfiwmkyfsifntelsqsnieerykiqs

Timeline for d4kbbb1:

• d4kbbb1 first appeared in SCOPe 2.03
  
• d4kbbb1 appears in SCOPe 2.05
  
• d4kbbb1 appears in SCOPe 2.07
  
• d4kbbb1 appears in the current release, SCOPe 2.08