Lineage for d4k8ea_ (4k8e A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080304Protein Old yellow enzyme (OYE) [51401] (2 species)
  7. 2080305Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [51402] (20 PDB entries)
  8. 2080308Domain d4k8ea_: 4k8e A: [235116]
    automated match to d4h4ia_
    complexed with 0wv, cl, fmn, mg, na, peg, pge; mutant

Details for d4k8ea_

PDB Entry: 4k8e (more details), 1.27 Å

PDB Description: OYE1-W116V complexed with the aromatic product of (R)-carvone dismutation
PDB Compounds: (A:) nadph dehydrogenase 1

SCOPe Domain Sequences for d4k8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8ea_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlvvlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk

SCOPe Domain Coordinates for d4k8ea_:

Click to download the PDB-style file with coordinates for d4k8ea_.
(The format of our PDB-style files is described here.)

Timeline for d4k8ea_: