Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4k71b2: 4k71 B:177-268 [235112] Other proteins in same PDB: d4k71a1, d4k71a2, d4k71a3, d4k71b1, d4k71c_, d4k71d1, d4k71d2, d4k71d3, d4k71e1, d4k71f_ automated match to d4k71e2 complexed with so4 |
PDB Entry: 4k71 (more details), 2.4 Å
SCOPe Domain Sequences for d4k71b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k71b2 b.1.1.2 (B:177-268) automated matches {Human (Homo sapiens) [TaxId: 9606]} keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha sssltvksgdehhyccivqhaglaqplrvele
Timeline for d4k71b2: