![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries) |
![]() | Domain d4k71b1: 4k71 B:5-176 [235111] Other proteins in same PDB: d4k71a1, d4k71a2, d4k71a3, d4k71b2, d4k71c_, d4k71d1, d4k71d2, d4k71d3, d4k71e2, d4k71f_ automated match to d4k71e1 complexed with so4 |
PDB Entry: 4k71 (more details), 2.4 Å
SCOPe Domain Sequences for d4k71b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k71b1 d.19.1.0 (B:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
Timeline for d4k71b1: