Lineage for d4k3yc_ (4k3y C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (15 species)
    not a true protein
  7. 2065420Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries)
  8. 2065493Domain d4k3yc_: 4k3y C: [235092]
    automated match to d4k3ya_
    complexed with ca

Details for d4k3yc_

PDB Entry: 4k3y (more details), 2.68 Å

PDB Description: Crystal structure of a subtype N11 neuraminidase-like protein of A/flat-faced bat/Peru/033/2010 (H18N11)
PDB Compounds: (C:) Neuraminidase

SCOPe Domain Sequences for d4k3yc_:

Sequence, based on SEQRES records: (download)

>d4k3yc_ b.68.1.0 (C:) automated matches {Influenza A virus [TaxId: 11320]}
atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgygtt
tnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsil
yggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwk
aldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtpr
gidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgn
rnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpd
vnwg

Sequence, based on observed residues (ATOM records): (download)

>d4k3yc_ b.68.1.0 (C:) automated matches {Influenza A virus [TaxId: 11320]}
atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgygvs
eqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsilyggiitdti
hptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwkaldttgfnf
efptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtprgidttnycd
ktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgnrnyqllsns
tigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpdvnwg

SCOPe Domain Coordinates for d4k3yc_:

Click to download the PDB-style file with coordinates for d4k3yc_.
(The format of our PDB-style files is described here.)

Timeline for d4k3yc_: