Lineage for d4k3wc_ (4k3w C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585424Species Marinobacter aquaeolei [TaxId:351348] [235089] (1 PDB entry)
  8. 1585427Domain d4k3wc_: 4k3w C: [235090]
    automated match to d2iexb_

Details for d4k3wc_

PDB Entry: 4k3w (more details), 2.31 Å

PDB Description: Crystal structure of an enoyl-CoA hydratase/isomerase from Marinobacter aquaeolei
PDB Compounds: (C:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4k3wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3wc_ c.14.1.0 (C:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}
cetlilekqgptlvitinrpdvrnamslqmvaelstifseiendisiraavlrgagghfc
aggdikdmagarsqkagegrddpfyklnrafgqmiqqvnesskvviaitegavmgggfgl
acvsdlaiagptakfgmpettlgvipaqiapfvverigltqarrlallglridateackl
givhqvaeseeqlsdmlnqalervrlcapdataetkallhrvgheamagllddaaekfaa
airgpegaegtmafmqkrepkwael

SCOPe Domain Coordinates for d4k3wc_:

Click to download the PDB-style file with coordinates for d4k3wc_.
(The format of our PDB-style files is described here.)

Timeline for d4k3wc_: