Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (35 species) not a true protein |
Species Staphylococcus aureus [TaxId:869816] [235084] (1 PDB entry) |
Domain d4k3va_: 4k3v A: [235085] automated match to d2o1eb_ complexed with mn |
PDB Entry: 4k3v (more details), 2.2 Å
SCOPe Domain Sequences for d4k3va_:
Sequence, based on SEQRES records: (download)
>d4k3va_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 869816]} gklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngl nletgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngik yvktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafk yfskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseet kkdifgevytdsigkegtkgdsyykmmksnietvhgsm
>d4k3va_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 869816]} gklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngl nletgngwfekaleqagkslkdkkviavskdvkpiylndkqdphawlsldngikyvktiq qtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafkyfskqy gitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetgevytdsigkegtkgdsyyk mmksnietvhgsm
Timeline for d4k3va_: