Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries) |
Domain d4k3ga_: 4k3g A: [235082] automated match to d4k3hc_ complexed with man |
PDB Entry: 4k3g (more details), 1.93 Å
SCOPe Domain Sequences for d4k3ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k3ga_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} avvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswtp grfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvls
Timeline for d4k3ga_: