Lineage for d4k3hg_ (4k3h G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742725Domain d4k3hg_: 4k3h G: [235080]
    automated match to d4k3hc_
    complexed with 1om, gol, man

Details for d4k3hg_

PDB Entry: 4k3h (more details), 2.45 Å

PDB Description: immunoglobulin lambda variable domain l5(l89s) fluorogen activationg protein in complex with malachite green
PDB Compounds: (G:) Immunoglobulin lambda variable domain L5(L89S)

SCOPe Domain Sequences for d4k3hg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3hg_ b.1.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl

SCOPe Domain Coordinates for d4k3hg_:

Click to download the PDB-style file with coordinates for d4k3hg_.
(The format of our PDB-style files is described here.)

Timeline for d4k3hg_: