Lineage for d4k1ga_ (4k1g A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088840Family c.1.15.1: Endonuclease IV [51659] (2 protein domains)
  6. 2088851Protein automated matches [191204] (2 species)
    not a true protein
  7. 2088852Species Escherichia coli K-12 [TaxId:83333] [235071] (1 PDB entry)
  8. 2088853Domain d4k1ga_: 4k1g A: [235072]
    automated match to d1qtwa_
    protein/DNA complex; complexed with peg, zn; mutant

Details for d4k1ga_

PDB Entry: 4k1g (more details), 1.9 Å

PDB Description: Structure of E. coli Nfo(Endo IV)-H69A mutant bound to a cleaved DNA duplex containing a alphadA:T basepair
PDB Compounds: (A:) Endonuclease 4

SCOPe Domain Sequences for d4k1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1ga_ c.1.15.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
ytsaqilpadsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
hdafrwimqddrfdgipliletinpdiwaeeiawlkaqqteka

SCOPe Domain Coordinates for d4k1ga_:

Click to download the PDB-style file with coordinates for d4k1ga_.
(The format of our PDB-style files is described here.)

Timeline for d4k1ga_: