SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4k1ga_ (4k1g A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088840Family c.1.15.1: Endonuclease IV [51659] (2 protein domains)
  6. 2088851Protein automated matches [191204] (2 species)
    not a true protein
  7. 2088852Species Escherichia coli K-12 [TaxId:83333] [235071] (1 PDB entry)
  8. 2088853Domain d4k1ga_: 4k1g A: [235072]
    automated match to d1qtwa_
    protein/DNA complex; complexed with peg, zn; mutant

Details for d4k1ga_

PDB Entry: 4k1g (more details), 1.9 Å

PDB Description: Structure of E. coli Nfo(Endo IV)-H69A mutant bound to a cleaved DNA duplex containing a alphadA:T basepair
PDB Compounds: (A:) Endonuclease 4

SCOPe Domain Sequences for d4k1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1ga_ c.1.15.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
ytsaqilpadsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
hdafrwimqddrfdgipliletinpdiwaeeiawlkaqqteka

SCOPe Domain Coordinates for d4k1ga_:

Click to download the PDB-style file with coordinates for d4k1ga_.
(The format of our PDB-style files is described here.)

Timeline for d4k1ga_: