SCOPe 2.03: Domain d4jxha_: 4jxh A:

Lineage for d4jxha_ (4jxh A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.0: automated matches [191673] (1 protein)
   not a true family

6. Protein automated matches [191283] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189904] (7 PDB entries)

8. Domain d4jxha_: 4jxh A: [235061]
   automated match to d4jwla_
   complexed with hrc, po4

Details for d4jxha_

PDB Entry: 4jxh, 1.47 Å

PDB Description: Complexe of ARNO Sec7 domain with the protein-protein interaction inhibitor N-(4-hydroxy-2,6-dimethylphenyl)benzenesulfonamide at pH 8.5

PDB Compounds: (A:) Cytohesin-2

SCOPe Domain Sequences for d4jxha_:

Sequence; same for both SEQRES and ATOM records:

>d4jxha_ a.118.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdy
lgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclc
npgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrnl
ydsirnepfkipedd

Timeline for d4jxha_:

• d4jxha_ is new in SCOPe 2.03-stable
  
• d4jxha_ appears in SCOPe 2.04
  
• d4jxha_ appears in the current release, SCOPe 2.08, called d4jxha1