SCOPe 2.07: Domain d4juza2: 4juz A:241-341

Lineage for d4juza2 (4juz A:241-341)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)

8. Domain d4juza2: 4juz A:241-341 [235050]
   Other proteins in same PDB: d4juza1
   automated match to d1jx4a1
   protein/DNA complex; complexed with ca, dgt

Details for d4juza2

PDB Entry: 4juz, 2.65 Å

PDB Description: Ternary complex of gamma-OHPDG adduct modified dna (zero primer) with dna polymerase iv and incoming dgtp

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d4juza2:

Sequence; same for both SEQRES and ATOM records:

>d4juza2 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d4juza2:

• d4juza2 first appeared in SCOPe 2.03
  
• d4juza2 appears in SCOPe 2.06
  
• d4juza2 appears in the current release, SCOPe 2.08