Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
Protein Rhinovirus coat protein [49670] (5 species) |
Species Human rhinovirus 14 [TaxId:12131] [49671] (27 PDB entries) |
Domain d1rmu1_: 1rmu 1: [23504] |
PDB Entry: 1rmu (more details), 3 Å
SCOP Domain Sequences for d1rmu1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rmu1_ b.10.1.4 (1:) Rhinovirus coat protein {Human rhinovirus 14} tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa ynyfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr apralpytsigrtnypkntepvikkrkgdiksy
Timeline for d1rmu1_: